Sale!

weprideourselvesongivingeachcustomerweserveasiftheyarefamilymembersfindingthe10pcsmandalapatterntilewallstickerswaterresistantwallpaperremovabledecalforkitchenbathrooms0.jpg

10Pcs Mandala Pattern Tile Wall Stickers Water Resistant Wallpaper Removable Decal for Kitchen Bathroom-Style 2 fancygrab

Original price was: $ 17,55.Current price is: $ 10,53.

SKU: mode_7038774706308 Category: Decorative Stickers Tag: Decorative Stickers

Description
shopping

Designed to cover dirty marks and protect the wall from oil or stains, you can freshen the tile of the kitchen or bathroom surface in a short period of time.

Features:

Easy installation, peel off the adhesive liner and stick it to any dry, flat surface.
Have a strong adhesive that is also removable and repositionable.
Removal will not leave residue and damage the wall.
Easy to clean with water or a dishcloth.
Trim each sticker by scissors to fit around outlets and in tiny corners.
Made of eco-friendly PVC material, waterproof and oil-proof.
Not easy to crack and fade, durable and can be used for a long time.
Can be used for bathrooms and kitchens, shower areas, doors, wardrobes and more.
A great home decoration wall sticker.

Specifications:

Material: PVC
Size(LxW): 20 x 20cm

Package Contents:

10 x Tile Wall Stickers

Note:

1. Peel off the protective film above the sticker before use.
2. Please allow 1-2cm measuring deviation due to manual measurement.
3. Due to the different monitor and light effects, the actual colour of the item might be slightly different from the colour shown in the pictures.

Professional packing and fast shipping

Through our long-term relationship with UPS, FedEx, DHL as well as a range of other leading global carriers, we can offer a variety of shipping options. Our warehouse staff are trained to package your goods precisely according to the specifications we provide. Your goods are thoroughly checked and properly secured before shipping. Everyday we deliver thousands of packages to clients across many countries. This is a sign of our dedication to being the biggest online retailer in the world. Both Europe as well as the USA have distribution and warehouse centers.

Note: Orders with more than one item are assigned a specific processing time, dependent on the particular item.

Before shipment, all ordered products will be thoroughly inspected. The majority of orders will be shipped within 48 hours. The time to deliver varies from 3-7 days.

Returns

Stock is dynamic, and is not completely managed by us because of the involvement of multiple entities, including the factory as well as our warehouse. Actual stock levels may fluctuate at any moment. It's possible that you may not receive your order once it has been placed.

Our policy is valid for a period of 30 days. We will not return or exchange your purchase if it has been 30 days since you purchased it.

You can only return a product in the event that it is not used and in the same condition as when you received it. You must have the item in its original packaging.

10Pcs Mandala Pattern Tile Wall Stickers Water Resistant Wallpaper Removable Decal for Kitchen Bathroom-Style 2 fancygrab

Related products

Login